
BBLLAACCKKYYEELLLLOOWWMMAAGGEENNTTAACCYYAANNVITEKSAGA “ST” Series 4, 8, and 16 Channel DigitalVideo Recorders• The Industry’s only MPEG4 Compression w
SAGA “ST” Series 9 TABLE OF CONTENTS PACKAGE CONTENTS...1 RI
SAGA “ST” Series 99 6.4.2 EVENT SCREEN MODE Define how the main video output reacts when an event occurs. z SCREEN HOLD: maintains the current v
SAGA “ST” Series 100 6.4.5 EVENT MESSAGE RESET Select the duration of the event message to be displayed from 1 to 30 seconds. The default is 5 sec
SAGA “ST” Series 101 6.4.8 RELAY OUTPUT Highlight RELAY OUTPUT and then press the ENTER button to access the relay output submenu. The firs
SAGA “ST” Series 102 6.5 SYSTEM System setup defines various system settings such as hard disk drive settings, system clock, password for multiple
SAGA “ST” Series 103 The DVR detects installed hard disk drives automatically. Any hard disk drive can be defined to be a normal recording drive (REC
SAGA “ST” Series 104 6.5.1.3 Backup HDD initialize The backup hard disk drives can be initialized at any time by accessing this menu. Highlight BACK
SAGA “ST” Series 105 Advance through the year, month, date and time by using the directional buttons, and use the + or – button to adjust the values.
SAGA “ST” Series 106 Select the time zone for the local time. For the list of the time zone for your local area, please see Appendix I on page 175.
SAGA “ST” Series 107 6.5.4 LANGUAGE Select from seven available language settings: z English z Korean z Japanese z Polish z Spanish z Russian
SAGA “ST” Series 108 6.5.7 ADVANCED SETUP The DVR’s passwords and different access levels can be configured from the Advanced Menu, as well as saving
SAGA “ST” Series 10 4.4 FREEZE... 36 4.4.1 SI
SAGA “ST” Series 109 Enter eight numbers for the new password, and then re-enter the same password under RE-TYPE section. The asterisks will advance
SAGA “ST” Series 110 Select YES and then press the ENTER button to reset back to factory default. Select NO to exit without resetting. 6.5.7.
SAGA “ST” Series 111 When saving the DVR menu settings is successful, the DVR will display “ENV COPY SUCCESS”. 6.5.9 FIRMWARE UPGRADE The DV
SAGA “ST” Series 112 Once the file is found, it will check for the integrity of the file. If the integrity of the file is intact, then it wil
SAGA “ST” Series 113 6.6 LINK Link setup defines various settings between the DVR and various devices such as internet connection, keyboard control
SAGA “ST” Series 114 Define the IP address if the DHCP is set to off. The DVR should be provided with its own static IP address. Define the s
SAGA “ST” Series 115 Define the primary dynamic IP server’s address if a proprietary server is to be setup and used in conjunction with the DVR. Vi
SAGA “ST” Series 116 Select the communication speed. Available speeds are from 1200 to 115200. The default speed is 115200. Select the data
SAGA “ST” Series 117 Select the DVR’s system ID between 0 to 255. The system ID should be issued when controlling multiple DVRs with a keyboard contr
SAGA “ST” Series 118 6.6.4 PTZ The DVR can control as many Pan / Tilt / Zoom cameras as many as the number of channels it records on. As there are
SAGA “ST” Series 11 6.1.5 PRE-RECORD TIME... 77 6.1.6 POST-RECORD TIME...
SAGA “ST” Series 119 Select the communication speed. Available speeds are from 1200 to 115200. The default is 9600. Select and match the P
SAGA “ST” Series 120 6.6.5.2 SMTP server Highlight SMTP SERVER and then press the ENTER button to define an e-mail server. Enter the e-mail
SAGA “ST” Series 121 6.6.5.4 User ID Highlight USER ID and then press the ENTER button to define the user ID for the DVR’s e-mail account. En
SAGA “ST” Series 122 6.6.5.6 E-mail address 1 through 10 Highlight a desired e-mail address to send the notifications to, and then press the ENTER bu
SAGA “ST” Series 123 VII. SEARCH Please see 5.4 ADVANCED PLAYBACK under section V. ADVANCED OPERATION on page 59. VIII. COPY Please see 5.1 B
SAGA “ST” Series 124 IX. EXIT Any and all settings must be saved in order to be put into effect. After any setting has been modified, the ESC butt
SAGA “ST” Series 125 9.3 EXIT WITHOUT SAVE Highlight and press the ENTER button to disregard any changes and exit to the live screen view mode.
SAGA “ST” Series 126 X. CLIENT PROGRAM: DVR VIEWER The DVR Viewer is a dedicated client program that connects to, monitors and manages up to 16 DVRs
SAGA “ST” Series 127 Click on NEXT. The DVR viewer will be installed in its default folder of C:\Program Files\DVR\DVR-Viewer. If the folder
SAGA “ST” Series 128 10.3 DVR VIEWER - LAYOUT Locate the DvrViewer icon on the desktop and double-click on it to run the client software. The progra
SAGA “ST” Series 12 6.5.7.3 User Authority... 109 6.5.7.4 DVR Menu Setup .
SAGA “ST” Series 129 1. DVR LIST The DVR List adds or removes individual DVRs and offers a variety of connection options. a. DVR List The DVRs
SAGA “ST” Series 130 e. Use IP Server The DVR can be located on the internet using the MAC address displayed in the status screen. If the MAC addres
SAGA “ST” Series 131 2. DVR SEARCH Within a local area network environment (LAN), it is possible to automatically scan and list available DVRs to be a
SAGA “ST” Series 132 3. HDD SEARCH The hard disk drive from the DVR can be directly connected to a PC, where the files can be searched and played back
SAGA “ST” Series 133 If the desired file is not listed in the current folder, then select the folder in which the files are saved by clicking on FOLDE
SAGA “ST” Series 134 6. VIEWER OPTION Viewer option defines the administrative options for the DVR Viewer, such as display options and
SAGA “ST” Series 135 a. Display Check or uncheck various On Screen Display options as needed. By default, Channel Title, Event and Frame Rate are ch
SAGA “ST” Series 136 Modify the administrator’s description and passwords as needed. Up to 20 alphanumeric characters can be entered for the password
SAGA “ST” Series 137 7. CHANNEL DISPLAY WINDOW Live or playback video from the DVR is transmitted and displayed up to 16 channels. Each channel disp
SAGA “ST” Series 138 identical to the front buttons of the SAGA “ST” series DVR. For more information on button functions, please see 2.1 FRONT PANEL
SAGA “ST” Series 13 10.6.3.1 Record... 161 10.6.3.2 Record Progra
SAGA “ST” Series 139 18. STATUS Displays the current DVR status on System, Record and Network. 18.1 System System status displays the following in
SAGA “ST” Series 140 19. PRINT In live or playback mode, select any of the channels and then click on PRINT to bring up the screen print window.
SAGA “ST” Series 141 20. COPY The data on the DVR can be downloaded onto the PC using the COPY function. The data can also be backed up directly onto
SAGA “ST” Series 142 h. DVR media Select the media on which the DVR will utilize for backup. All three USB ports and the internal DVD burner can be s
SAGA “ST” Series 143 a. Log list window List of DVR logs from the most recent to the oldest. b. Search Click on search to view available log l
SAGA “ST” Series 144 b. Rewind This button can be toggled for rewind speed of 2x, 4x, 8x, 16x, 32x, 64x and 128x. c. Reverse slow This button can be
SAGA “ST” Series 145 34. LIVE / PLAYBACK BUTTON STATUS During live or playback, this window will display the direction and the speed of the playback d
SAGA “ST” Series 146 10.4 DVR VIEWER - LIVE MODE Click on the DVR LIST, highlight a desired DVR and then click on CONNECT. a. DVR’s l
SAGA “ST” Series 147 c. Channel window The DVR channel window can be double-clicked for a full screen mode. The channel window can also be zoomed by
SAGA “ST” Series 148 10.5 DVR VIEWER – PLAYBACK MODE Any DVRs that are connected online can be accessed to do data search remotely from the DVR and
SAGA “ST” Series 14 I. FEATURE HIGHLIGHTS 1.1 OPERATION A. PENTAPLEX PLUS FUNCTION Simultaneous record, playback, mirror, backup, network transmiss
SAGA “ST” Series 149 d. DVR functions Some of the DVR functions may not be available depending on what user account the DVR Viewer has been signed on
SAGA “ST” Series 150 Select the channel for playback. Select the year, month, day and time for the playback, or slide the time bar to the
SAGA “ST” Series 151 10.5.3 EVENT Click on EVENT to display the Event Search window. The first 500 events are listed chronologically, from the mos
SAGA “ST” Series 152 Select the year, month, day and time for the end of the event list for playback. The list can be advanced to the next
SAGA “ST” Series 153 Select the channel for the text string search. Enter the text string to search. Leave blank for a wild card (all i
SAGA “ST” Series 154 Highlight a text string, and then click on PLAY to begin the remote playback. The listing can be saved as a List file f
SAGA “ST” Series 155 Select the year, month, day and time for the end of the data. If the desired date and time is not found, then click on
SAGA “ST” Series 156 10.6 DVR PLAYER – SETUP The DVR Viewer can change the settings on the DVR remotely. The features and settings are identical to
SAGA “ST” Series 157 5. SYSTEM SETUP 6. LINK 7. DOWNLOAD Update the DVR’s firmware using the download menu. 8. READ FROM FILE Load DVR settings
SAGA “ST” Series 158 10.6.2 SCREEN 10.6.2.1 Auto Sequence a. Auto-Single: select the single channel dwell time. b. Auto-Split: select the mult
SAGA “ST” Series 15 1.3 PLAYBACK A. MULTI-SCREEN Single, quad, 6, 7, 9, 10, 13 and 16 channel playback. B. VERSATILE SEARCH OPTIONS Calendar, sea
SAGA “ST” Series 159 10.6.2.4 Title a. Channel Title (text mode) Enter up to eight alphanumeric characters for channel titles. b. Clear Clear t
SAGA “ST” Series 160 10.6.2.5 Multiscreen Customize the channels to be displayed in 4E, 6, 7, 9B, 10 and 13 channel view modes. 10.6.2.6
SAGA “ST” Series 161 10.6.3 RECORD 10.6.3.1 Record a. Schedule Record: click on a hour block and then click Schedule Record on / off. b. Monday
SAGA “ST” Series 162 10.6.3.3 Holiday a. Holiday Record: on / off. b. Holiday Setup: enter the holidays. 10.6.4 EVENT 10.6.4.1 Even
SAGA “ST” Series 163 Select the grid size. Use the left mouse button to draw motion detection area and use the right mouse button to erase motion d
SAGA “ST” Series 164 10.6.5 SYSTEM 10.6.5.1 System a. Video Standard: PAL, NTSC, auto. b. Language: English, Korean, Japanese, Polish, Spanish,
SAGA “ST” Series 165 10.6.5.3 PASSWORD a. Password Check: on / off b. Passwords: define the DVR access passwords for all users. c. Authority: de
SAGA “ST” Series 166 10.6.6.3 RS-485 a. System ID: select the system ID. b. Output Mode: select the output mode. c. Baud Rate: select the comm
SAGA “ST” Series 167 10.6.7 DOWNLOAD The DVR’s firmware can be updated from the client software. Please remember that once the upgrade process begi
SAGA “ST” Series 168 The file will begin loading onto the DVR. Once the download is complete, the DVR will begin flashing the new firmwa
SAGA “ST” Series 16 1.6 STORAGE A. GENEROUS STORAGE CAPACITY Two available internal hard drive bays allow up to 1.5 terabyte of storage and optional
SAGA “ST” Series 169 XI. SPECIFICATIONS 11.1 VT-ST420 Video Video Standard NTSC & PAL Standards, automatic configuration Video Input 4 Chan
SAGA “ST” Series 170 Storage Internal Storage 2 Hard Drives, 1 removable, 2.25 Terabytes Maximum External Storage 40 Hard Drives, 30 Terabytes M
SAGA “ST” Series 171 11.2 VT-ST820 Video Video Standard NTSC & PAL Standards, automatic configuration Video Input 8 Channels BNC Input Level
SAGA “ST” Series 172 Storage Internal Storage 2 Hard Drives, 1 removable, 2.25 Terabytes Maximum External Storage 40 Hard Drives, 30 Terabytes M
SAGA “ST” Series 173 11.3 VT-ST1620 Video Video Standard NTSC & PAL Standards, automatic configuration Video Input 16 Channels BNC Input Lev
SAGA “ST” Series 174 Storage Internal Storage 2 Hard Drives, 1 removable, 2.25 Terabytes Maximum External Storage 40 Hard Drives, 30 Terabytes M
SAGA “ST” Series 175 XII. TECHNICAL SUPPORT Please read the manual thoroughly before contacting the vendor or the manufacturer. If you still have qu
SAGA “ST” Series 176 APPENDIX I TIME ZONE LISTING GMT-12:00 International Date Line West GMT-11:00 Midway Island, Samoa GMT-10:00 Hawaii GMT-09:00
SAGA “ST” Series 177 GMT+03:00 Nairobi GMT+03:30 Tehran GMT+04:00 Abu Dhabi, Muscat GMT+04:00 Baku, Tbilisi, Yeveran GMT+04:30 Kabul GMT+05:00 Ekate
SAGA “ST” Series 178 INDEX A ADVANCED OPERATION ...47, 123 ADVANCED PLAYBACK...59 AD
SAGA “ST” Series 17 II. SAGA “ST” SERIES DIGITAL VIDEO RECORDER LAYOUT 2.1 FRONT PANEL LAYOUT 1. AUDIO SELECT This button selects the recorde
SAGA “ST” Series 179 FREEZE...19, 24, 36, 37 FULL SCREEN DISPLAY ...
SAGA “ST” Series 180 RS-485...21 RS-485...
SAGA “ST” Series 181 NOTES
SAGA “ST” Series 182 NOTES
28492 CONSTELLATION ROAD VALENCIA, CA 91355WWW.VITEKCCTV.COM | 888-VITEK-70
SAGA “ST” Series 18 8. PLAY / PAUSE / ZOOM OUT a) Starts the playback of recorded data. By default, the playback starts from the earliest recording
SAGA “ST” Series 1 PACKAGE CONTENTS Prior to installation of the SAGA series DVR, please verify that the packaging contains the following contents:
SAGA “ST” Series 19 16. PIP / LOOP PLAYBACK CLEAR / DOWN DIRECTIONAL BUTTON a) Activates the picture-in-picture mode. b) Tilts down in PTZ mode. c
SAGA “ST” Series 20 2.2 REAR PANEL LAYOUT VT-ST420 VT-ST820 VT-ST1620 15 4 32786 109 11 12 13 1716 15 14 1815 4 32786 109
SAGA “ST” Series 21 1. CAMERA INPUT BNC connectors for composite video signal input. 2. SPOT OUTPUT Spot monitor BNC connector for composite vide
SAGA “ST” Series 22 15. RELAY OUT Terminal blocks for relay out 1 through 4. 16. TIME SYNCHRONIZATION Input and Output terminal blocks for time
SAGA “ST” Series 23 2.3 IR REMOTE CONTROLLER 1. REMOTE CONTROLLER ID Select the remote controller ID. 2. IRIS C
SAGA “ST” Series 24 6. ALARM RESET / LEFT DIRECTIONAL BUTTON 7. MENU / UP DIRECTIONAL BUTTON 8. PIP / DOWN DIRECTIONAL BUTTON 9. DIGITAL ZOOM /
SAGA “ST” Series 25 2.4 MOUSE CONTROL 1. LEFT MOUSE BUTTON a) Double-click in the main window: status display. b) Double-click in the me
SAGA “ST” Series 26 III. INSTALLATION AND CONNECTIONS 3.1 CONNECTIONS LAYOUT
SAGA “ST” Series 27 3.2 VT-XHD10U
SAGA “ST” Series 28 3.3 EXTERNAL TERMINAL CONNECTION 3.3.1 RS-485 3.3.2 TIME ADJUST No DESCRIPTION 1 TA(TX+) RS485:Transmit
SAGA “ST” Series 2 RISK OF ELECTRICAL SHOCK WARNING TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOSE THIS PRODUCT TO RAIN OR MOISTURE.
SAGA “ST” Series 29 3.3.3 RELAY OUTPUT 3.3.4 ALARM SENSOR INPUT NO DESCRIPTION NO DESCRIPTION 1 NO(Normal Open) 7 NO(Norma
SAGA “ST” Series 30 3.3.5 VGA PIN LAYOUT 3.3.6 RS-232C PIN LAYOUT No DESCRIPTION 1 RED(Red Video [75ohm, 0.7Vp-p] ) 2 GREEN(Green
SAGA “ST” Series 31 IV. BASIC OPERATION This section will cover basic features of the DVR, including its main screen and the explanation of some of t
SAGA “ST” Series 32 3. DATE AND TIME Current date and time is displayed when in live monitoring mode. Recorded date and time is displayed when in
SAGA “ST” Series 33 5. RECORD PROGRAM Displays current recording program. 6. RECORD TYPE Displays current event recording mode. 7. SOFTWARE
SAGA “ST” Series 34 4.3 LIVE VIEW The live view displays each channel at 30 frames per second, for the total of 120 frames per second for VT-ST420, 2
SAGA “ST” Series 35 4.3.1.2 VT-ST820 4.3.2 FULL SCREEN DISPLAY Press the desired channel
SAGA “ST” Series 36 Press +10 button and then 2 button to display channel 12. 4.3.3 AUTOMATIC SEQUENCE Press the SEQ button to activate the
SAGA “ST” Series 37 4.4.1 SINGLE SCREEN VIEW MODE In single screen view mode, press the FREEZE button to freeze the live screen. As the scr
SAGA “ST” Series 38 4.5 ZOOM During the live view mode or during the playback mode, it is possible to zoom into a section of the screen to get a digi
SAGA “ST” Series 3 DISCLAIMER While every effort has been made to ensure that the information contained in this guide is accurate and complete, no
SAGA “ST” Series 39 4.6 PICTURE-IN-PICTURE Select the background channel by pressing the desired numeric button. Press the PIP button to activ
SAGA “ST” Series 40 4.7 SPOT MONITOR The spot monitor allows viewing of individual cameras in live mode while the main monitor may be busy with diffe
SAGA “ST” Series 41 4.8 BASIC RECORDING When the REC button is pressed, the SAGA series DVR uses Program 6, which is the default record setting: T
SAGA “ST” Series 42 4.9 BASIC PLAYBACK 4.9.1 PLAY / REVERSE PLAY / PAUSE / STOP Press the PLAY / PAUSE button and the play icon will be displayed.
SAGA “ST” Series 43 4.9.2 FAST FORWARD / REWIND The FAST button accelerates the speed of playback in one direction. Each pressing of the button acce
SAGA “ST” Series 44 4.9.4 SLOW The SLOW button slows down the speed of playback in one direction. Each pressing of the button further slows down the
SAGA “ST” Series 45 As soon as the end of the loop is marked, then the playback returns to POSITION A. When the end the loop is reached, the pl
SAGA “ST” Series 46 4.9.7 AUDIO PLAYBACK The audio is always recorded in real time regardless of the recording speed. To listen into the desired aud
SAGA “ST” Series 47 V. ADVANCED OPERATION This section will cover advanced features of the DVR such as backup (copy), pan tilt and zoom camera contro
SAGA “ST” Series 48 Select INTERNAL CD-RW/DVD by pressing the + or = buttons. Highlight MEDIA FORMAT, and then press the ENTER button to begi
SAGA “ST” Series 4 FCC NOTICE Saga Series Digital Video Recorders, VT-ST420, VT-ST820, VT-ST1620 These devices comply with Part 15 of the FCC Rules.
SAGA “ST” Series 49 Select the location of the file to be backed up from. If the location is unknown, leave the HDD ID on NORMAL. Select the
SAGA “ST” Series 50 The backup progress is displayed on the right upper corner of the screen, and will disappear automatically when the backup process
SAGA “ST” Series 51 The beginning and the end of the available files are listed automatically as shown on the left. Select the beginning time
SAGA “ST” Series 52 Insert the CD into the CD-ROM or DVD-ROM of a computer, and the small player will load automatically showing all available data fo
SAGA “ST” Series 53 Select the location of the file to be backed up from. If the location is unknown, leave the HDD ID on NORMAL. Select the
SAGA “ST” Series 54 The backup progress is displayed on the right upper corner of the screen, and will disappear automatically when the backup process
SAGA “ST” Series 55 Displays the current copy status. 5.1.6 COPY STOP The backup process can be interrupted at any time during the process
SAGA “ST” Series 56 Highlight YES and then press the ENTER button to stop the backup process. 5.2 PAN / TILT / ZOOM CAMERA CONTROL The SAGA
SAGA “ST” Series 57 5.2.2 CREATING AND MOVING TO PRESET POINTS During the PTZ control mode, press the PRESET button to activate the PTZ(PRESET)MOVE m
SAGA “ST” Series 58 notification e-mails if the e-mail addresses have been defined. Please see 6.4.8 RELAY OUTPUT under 6.4 EVENT SETUP section on pa
SAGA “ST” Series 5 Read this First Test Sessions Before you try to record important subjects, we highly recommend that you make several test session
SAGA “ST” Series 59 5.3.3 MOTION RECORDING Motion recording is yet another effective form of event recording that is triggered when a channel detects
SAGA “ST” Series 60 The dates that contain recorded data will be displayed in clear font, whereas dates without data will be in white. Select
SAGA “ST” Series 61 5.4.2 SEARCH & COPY Search & copy allows a quick review of the recorded data and backup onto a medium, and thus minimizes
SAGA “ST” Series 62 If any of the channels need to be viewed in full screen mode, highlight CHANNEL and then press the + or – button to view a specifi
SAGA “ST” Series 63 When the password has been entered, “SAVE NEW COPY PASSWORD” will appear. The same message appears even if the ESC button has bee
SAGA “ST” Series 64 Select which hard disk drive to retrieve the data from. If unknown, leave the HDD ID on “NORMAL”. Select the year, month
SAGA “ST” Series 65 Press the SEARCH button to access the search screen. Highlight EVENT SEARCH and then press the ENTER button to access the
SAGA “ST” Series 66 Select the year, month, date, hour, minutes and seconds of the end of the data to retrieve. As the values change, the picture in
SAGA “ST” Series 67 Highlight BLOCK SEARCH and then press the ENTER button to access the BLOCK SEARCH screen. Select the hard disk drive to re
SAGA “ST” Series 68 Maneuver through the playback as needed. Please see BASIC PLAYBACK on page 42. 5.4.6 FILE SEARCH File search is capable
SAGA “ST” Series 6 SAFETY PRECAUTIONS Before using the Digital Video Recorder, please ensure that you read and understand the safety precautions de
SAGA “ST” Series 69 Press the ENTER button and the list of data will appear in chronological order, from the oldest to the most recent. Select
SAGA “ST” Series 70 Press the ENTER button to search for the list of bookmarks. Select the bookmark, and then press the ENTER button to start
SAGA “ST” Series 71 Highlight TEXT SEARCH and then press the ENTER button to access Text Search submenu. Select the hard disk drive to retri
SAGA “ST” Series 72 Enter the text to be searched. Leave black for a wild card (all item) search. Move the highlight to any location beside
SAGA “ST” Series 73 z Power on / off z Power loss / DVR restart z Changes in the menu z DVR initialization z HDD initialization z Network connec
SAGA “ST” Series 74 Press the ESC button and highlight SAVE LOG and then press the ENTER button to save the log file onto a USB flash memory. The USB
SAGA “ST” Series 75 VI. DVR MENU Press the MENU button to access the main menu of the DVR. The DVR menu consists of the following categories: Q
SAGA “ST” Series 76 6.1 QUICK SETUP Quick setup enables the user to quickly setup major recording settings of the DVR. All changes made in quick s
SAGA “ST” Series 77 6.1.3 RECORD FRAME Record frame determines the overall recording speed of the DVR. The recording speed adjusts automatically acc
SAGA “ST” Series 78 6.1.6 POST-RECORD TIME Define the post-event recording time. Select from 0 to 60 seconds. The default is ten seconds.
SAGA “ST” Series 7 Do not allow the equipment to come into contact with, or become immersed in, water or other liquids. Do not allow liquids to ent
SAGA “ST” Series 79 For more information regarding the REMOTE CONTROL ID, please see 6.5.6 REMOTE CONTROLLER ID under SYSTEM menu on page 107. The de
SAGA “ST” Series 80 The second page lists the sequence display duration for the nine channel display mode A and B, ten channel display mode, 13 channe
SAGA “ST” Series 81 6.2.2 DISPLAY Highlight DISPLAY and then press the ENTER button to access the display submenu. Select the display option
SAGA “ST” Series 82 Select the date format. The default is DD/MM/YY. Select the display option for the channel title. The default is on.
SAGA “ST” Series 83 6.2.3 TITLE Highlight TITLE and then press the ENTER button to access the title submenu. Press the enter button to edit
SAGA “ST” Series 84 Select a view mode to customize. The view mode can be disabled to be removed from the sequence of view modes. The def
SAGA “ST” Series 85 The second page lists the covert mode options for channels 9 through 16. Highlight the desired channel and press the + or – but
SAGA “ST” Series 86 Select the spot monitor display mode: z Manual z Event z Sequenced The default is manual. Define the spot monitor sequenc
SAGA “ST” Series 87 Adjust the brightness. The default is 50%. Adjust the contrast. The default is 50%. Adjust the hue. The defau
SAGA “ST” Series 88 6.3 RECORD Record setup defines various recording options such as record schedule, record programs, recording time estimate, au
SAGA “ST” Series 8 PREVENTING MALFUNCTION Avoid Strong Magnetic Fields. Never place the Digital Video Recorder in close proximity to electric mot
SAGA “ST” Series 89 1. All Select the program for the whole day by changing the value in this section. 2. Current hour block Highlights the
SAGA “ST” Series 90 Any of the record settings can be customized once in the record program mode. Any changes made will be effective only to the hour
SAGA “ST” Series 91 2. EVENT RECORD SETTING The DVR offers two distinctive methods for recording events: SINGLE mode versus COMPLEX mode. Furthermo
SAGA “ST” Series 92 When the REC button is on, this setup continuously takes one picture per second until a movement is detected, where the record rat
SAGA “ST” Series 93 The illustration shows that at any given time, a channel would record at 30 PPS when an alarm circuit is triggered, whereas the re
SAGA “ST” Series 94 6.3.3 IMAGE QUALITY Image quality predicts how much time the DVR will record based on the record settings. Highlight IMAGE QUA
SAGA “ST” Series 95 6.3.5 REPEAT RECORD Highlight REPEAT RECORD and then press the ENTER button to access the audio record submenu. Select t
SAGA “ST” Series 96 6.3.7 BACKUP MODE Select the recording mode for the backup hard disk drives. Available options are: z MIRROR: create a real-t
SAGA “ST” Series 97 6.4 EVENT Event setup defines various event options such as the motion grid and the motion detection sensitivity, the main scre
SAGA “ST” Series 98 Adjust the sensitivity of the motion detection from 1 to 5 by pressing the + or – buttons. The default is 5. Highlight A
Komentarze do niniejszej Instrukcji