Vitek VT-XL1680 Instrukcja Obsługi

BBLLAACCKKYYEELLLLOOWWMMAAGGEENNTTAACCYYAANNVITEKSAGA “XL” Series 8 and 16 Channel DigitalVideo Recorders• The Industry’s only MPEG4 Compression with

SAGA “XL” Series 9 TABLE OF CONTENTS CONTENT VERIFICATION...

SAGA “XL” Series 99 6.3.4 AUDIO RECORD Highlight AUDIO RECORD and then press the ENTER button to access the audio record submenu. Enable or

SAGA “XL” Series 100 Select the threshold at which the alarm will sound. Select from 5% to 10%, or off. The default is 5%. 6.3.6 PLAY MODE

SAGA “XL” Series 101 6.3.8 HOLIDAY Highlight HOLIDAY and then press the ENTER button to access the holiday schedule screen. Select the holid

SAGA “XL” Series 102 6.4 EVENT Event setup defines various event options such as the motion grid and the motion detection sensitivity, the main scr

SAGA “XL” Series 103 Adjust the sensitivity of the motion detection from 1 to 5 by pressing the + or – buttons. The default is 5. Highlight

SAGA “XL” Series 104 6.4.2 EVENT SCREEN MODE Define how the main video output reacts when an event occurs. z SCREEN HOLD: maintains the current

SAGA “XL” Series 105 6.4.5 EVENT MESSAGE RESET Select the duration of the event message to be displayed from 1 to 30 seconds. The default is 5 sec

SAGA “XL” Series 106 6.4.8 RELAY OUTPUT Highlight RELAY OUTPUT and then press the ENTER button to access the relay output submenu. The firs

SAGA “XL” Series 107 6.5 SYSTEM System setup defines various system settings such as hard disk drive settings, system clock, password for multiple

SAGA “XL” Series 108 The DVR detects installed hard disk drives automatically. Any hard disk drive can be defined to be a normal recording drive (REC

SAGA “XL” Series 10 4.4 FREEZE... 37 4.4.1 SI

SAGA “XL” Series 109 6.5.1.3 Backup HDD Initialize The backup hard disk drives can be initialized at any time by accessing this menu. Highlight BACK

SAGA “XL” Series 110 Advance through the year, month, date and time by using the directional buttons, and use the + or – button to adjust the values.

SAGA “XL” Series 111 Select the time zone for the local time. For the list of the time zone for your local area, please see Appendix I on page 179

SAGA “XL” Series 112 6.5.4 LANGUAGE Select from seven available language settings: z English z Korean z Japanese z Polish z Spanish z Russian

SAGA “XL” Series 113 6.5.7 ADVANCED SETUP The DVR’s passwords and different access levels can be configured from the Advanced Menu, as well as saving

SAGA “XL” Series 114 Enter eight numbers for the new password, and then re-enter the same password under RE-TYPE section. The asterisks will advance

SAGA “XL” Series 115 Select YES and then press the ENTER button to reset back to factory default. Select NO to exit without resetting. 6.5.7.

SAGA “XL” Series 116 When saving the DVR menu settings is successful, the DVR will display “ENV COPY SUCCESS”. 6.5.8 FIRMWARE UPGRADE The DV

SAGA “XL” Series 117 Once the file is found, it will check for the integrity of the file. If the integrity of the file is intact, then it wil

SAGA “XL” Series 118 6.6 LINK Link setup defines various settings between the DVR and various devices such as internet connection, keyboard control

SAGA “XL” Series 11 6.1.3 RECORD FRAME... 79 6.1.4 EVENT...

SAGA “XL” Series 119 Define the IP address if the DHCP is set to off. The DVR should be provided with its own static IP address. Define the s

SAGA “XL” Series 120 Define the primary dynamic IP server’s address if a proprietary server is to be setup and used in conjunction with the DVR. Vi

SAGA “XL” Series 121 Select the communication speed. Available speeds are from 1200 to 115200. The default speed is 115200. Select the data

SAGA “XL” Series 122 Select the DVR’s system ID between 0 to 255. The system ID should be issued when controlling multiple DVRs with a keyboard contr

SAGA “XL” Series 123 Select the stop bit. Available options are 1 and 2. The default is 1. 6.6.4 PTZ The DVR can control as many Pan / Ti

SAGA “XL” Series 124 Highlight the desired channel number where the PTZ camera is connected, then scroll through the list of PTZ cameras and select th

SAGA “XL” Series 125 6.6.5.1 Send e-mail Select the e-mail notification on or off. The default is off. 6.6.5.2 SMTP server Highlight SMTP

SAGA “XL” Series 126 Enter the DVR’s e-mail address as assigned by the network administrator, or create one that conforms with the specification of th

SAGA “XL” Series 127 Enter the password to log into the DVR’s e-mail account. Press the ESC button to return to previous menu. 6.6.5.6 E-mai

SAGA “XL” Series 128 VII. SEARCH Please see 5.4 ADVANCED PLAYBACK under section V. ADVANCED OPERATION on page 61. VIII. COPY Please see 5.1

SAGA “XL” Series 12 6.5.4 VIDEO STANDARD... 111 6.5.4 LANGUAGE...

SAGA “XL” Series 129 IX. EXIT Any and all settings must be saved in order to be put into effect. After any setting has been modified, the ESC butt

SAGA “XL” Series 130 9.3 EXIT WITHOUT SAVE Highlight and press the ENTER button to disregard any changes and exit to the live screen view mode.

SAGA “XL” Series 131 X. CLIENT PROGRAM: DVR VIEWER The DVR Viewer is a dedicated client program that connects to, monitors and manages up to 16 DVRs

SAGA “XL” Series 132 Click on NEXT. The DVR viewer will be installed in its default folder of C:\Program Files\DVR\DVR-Viewer. If the folder

SAGA “XL” Series 133 10.3 DVR VIEWER - LAYOUT Locate the DvrViewer icon on the desktop and double-click on it to run the client software. The progra

SAGA “XL” Series 134 1. DVR LIST The DVR List adds or removes individual DVRs and offers a variety of connection options. a. DVR List The DVRs

SAGA “XL” Series 135 e. Use IP Server The DVR can be located on the internet using the MAC address displayed in the status screen. If the MAC addres

SAGA “XL” Series 136 2. DVR SEARCH Within a local area network environment (LAN), it is possible to automatically scan and list available DVRs to be a

SAGA “XL” Series 137 3. HDD SEARCH The hard disk drive from the DVR can be directly connected to a PC, where the files can be searched and played back

SAGA “XL” Series 138 If the desired file is not listed in the current folder, then select the folder in which the files are saved by clicking on FOLDE

SAGA “XL” Series 13 10.6.2.2 Auto Sequence... 163 10.6.2.3 Display ...

SAGA “XL” Series 139 6. VIEWER OPTION Viewer option defines the administrative options for the DVR Viewer, such as display options and

SAGA “XL” Series 140 a. Display Check or uncheck various On Screen Display options as needed. By default, Channel Title, Event and Frame Rate are ch

SAGA “XL” Series 141 Modify the administrator’s description and passwords as needed. Up to 20 alphanumeric characters can be entered for the password

SAGA “XL” Series 142 7. CHANNEL DISPLAY WINDOW Live or playback video from the DVR is transmitted and displayed up to 16 channels. Each channel disp

SAGA “XL” Series 143 and functions are identical to the front buttons of the SAGA “XL” series DVR. For more information on button functions, please s

SAGA “XL” Series 144 18. STATUS Displays the DVR’s current status on System, Record and Network. 18.1 System System status displays the following

SAGA “XL” Series 145 19. PRINT In live or playback mode, select any of the channels and then click on PRINT to bring up the screen print window.

SAGA “XL” Series 146 20. COPY The data on the DVR can be downloaded onto the PC using the COPY function. The data can also be backed up directly onto

SAGA “XL” Series 147 h. DVR media Select the media on which the DVR will utilize for backup. All three USB ports and the internal DVD burner can be s

SAGA “XL” Series 148 a. Log list window List of DVR logs from the most recent to the oldest. b. Search Click on search to view available log l

SAGA “XL” Series 14 I. FEATURE HIGHLIGHTS 1.1 OPERATION A. SEXTUPLEX FUNCTION Simultaneous record, playback, mirror, backup, network transmission an

SAGA “XL” Series 149 b. Rewind This button can be toggled for rewind speed of 2x, 4x, 8x, 16x, 32x, 64x and 128x. c. Reverse slow This button can be

SAGA “XL” Series 150 34. LIVE / PLAYBACK BUTTON STATUS During live or playback, this window will display the direction and the speed of the playback d

SAGA “XL” Series 151 10.4 DVR VIEWER - LIVE MODE Click on the DVR LIST, highlight a desired DVR and then click on CONNECT. a. DVR’s l

SAGA “XL” Series 152 c. Channel window The DVR channel window can be double-clicked for a full screen mode. The channel window can also be zoomed by

SAGA “XL” Series 153 10.5 DVR VIEWER – PLAYBACK MODE Any DVRs that are connected online can be accessed to do data search remotely from the DVR and

SAGA “XL” Series 154 d. DVR functions Some of the DVR functions may not be available depending on what user account the DVR Viewer has been signed on

SAGA “XL” Series 155 Select the channel for playback. Select the year, month, day and time for the playback, or slide the time bar to the

SAGA “XL” Series 156 10.5.3 EVENT Click on EVENT to display the Event Search window. The first 500 events are listed chronologically, from the mos

SAGA “XL” Series 157 Select the year, month, day and time for the end of the event list for playback. The list can be advanced to the next

SAGA “XL” Series 158 Select the channel for the text string search. Enter the text string to search. Leave blank for a wild card (all i

SAGA “XL” Series 15 1.3 PLAYBACK A. MULTI-SCREEN Single, quad, 6, 7, 9, 10, 13 and 16 channel playback. B. VERSATILE SEARCH OPTIONS Calendar, sea

SAGA “XL” Series 159 Highlight a text string, and then click on PLAY to begin the remote playback. The listing can be saved as a List file f

SAGA “XL” Series 160 Select the year, month, day and time for the end of the data. If the desired date and time is not found, then click on

SAGA “XL” Series 161 10.6 DVR PLAYER – SETUP The DVR Viewer can change the settings on the DVR remotely. The features and settings are identical to

SAGA “XL” Series 162 5. SYSTEM SETUP 6. LINK 7. DOWNLOAD Update the DVR’s firmware using the download menu. 8. READ FROM FILE Load DVR settings

SAGA “XL” Series 163 10.6.2 SCREEN 10.6.2.1 Position a. CRT: adjust the screen position for the main video output. b. VGA: adjust the screen pos

SAGA “XL” Series 164 10.6.2.4 Title a. Channel Title (text mode) Enter up to eight alphanumeric characters for channel titles. b. Clear Clear t

SAGA “XL” Series 165 10.6.2.5 Multiscreen Customize the channels to be displayed in 4E, 6, 7, 9B, 10 and 13 channel view modes. 10.6.2.6

SAGA “XL” Series 166 10.6.3 RECORD 10.6.3.1 Record a. Schedule Record: click on a hour block and then click Schedule Record on / off. b. Monday

SAGA “XL” Series 167 10.6.3.3 Holiday a. Holiday Record: on / off. b. Holiday Setup: enter the holidays. 10.6.4 EVENT 10.6.4.1 Even

SAGA “XL” Series 168 Select the grid size. Use the left mouse button to draw motion detection area and use the right mouse button to erase motion d

SAGA “XL” Series 16 1.6 STORAGE A. GENEROUS STORAGE CAPACITY Four available internal hard drive bays allow up to three terabytes of storage and opti

SAGA “XL” Series 169 10.6.5 SYSTEM 10.6.5.1 System a. Video Standard: PAL, NTSC, auto. b. Language: English, Korean, Japanese, Polish, Spanish,

SAGA “XL” Series 170 10.6.5.3 PASSWORD a. Password Check: on / off b. Passwords: define the DVR access passwords for all users. c. Authority: de

SAGA “XL” Series 171 10.6.6.3 RS-485 a. System ID: select the system ID. b. Output Mode: select the output mode. c. Baud Rate: select the comm

SAGA “XL” Series 172 10.6.7 DOWNLOAD The DVR’s firmware can be updated from the client software. Please remember that once the upgrade process begi

SAGA “XL” Series 173 The file will begin loading onto the DVR. Once the download is complete, the DVR will begin flashing the new firmwa

SAGA “XL” Series 174 XI. SPECIFICATIONS 11.1 VT-XL840 Video Video Standard NTSC & PAL Standards, automatic configuration Video Input 8 Chann

SAGA “XL” Series 175 Storage Internal Storage 4 Hard Drives, 1 removable, 3.75 Terabytes Maximum External Storage 40 Hard Drives, 30 Terabytes Ma

SAGA “XL” Series 176 11.2 VT-XL1680 Video Video Standard NTSC & PAL Standards, automatic configuration Video Input 16 Channels BNC Input Leve

SAGA “XL” Series 177 Storage Internal Storage 4 Hard Drives, 1 removable, 3.75 Terabytes Maximum External Storage 40 Hard Drives, 30 Terabytes Ma

SAGA “XL” Series 178 XII. TECHNICAL SUPPORT Please read the manual thoroughly before contacting the vendor or the manufacturer. If you still have qu

SAGA “XL” Series 17 II. SAGA “XL” SERIES DIGITAL VIDEO RECORDER LAYOUT 2.1 FRONT PANEL LAYOUT 1. POWER SWITCH This switch turns the DVR on o

SAGA “XL” Series 179 APPENDIX I TIME ZONE LISTING GMT-12:00 International Date Line West GMT-11:00 Midway Island, Samoa GMT-10:00 Hawaii GMT-09:00

SAGA “XL” Series 180 GMT+03:00 Nairobi GMT+03:30 Tehran GMT+04:00 Abu Dhabi, Muscat GMT+04:00 Baku, Tbilisi, Yeveran GMT+04:30 Kabul GMT+05:00 Ekate

SAGA “XL” Series 181 INDEX A ADVANCED OPERATION ...49, 128 ADVANCED PLAYBACK ...61

SAGA “XL” Series 182 FOCUS OUT...19, 24 FRAMES PER SECOND ...14

SAGA “XL” Series 183 RELAY OUTPUT...106 REMOTE CONTROL ID...80, 81, 112 REM

SAGA “XL” Series 184 NOTES

SAGA “XL” Series 185 NOTES

28492 CONSTELLATION ROAD VALENCIA, CA 91355WWW.VITEKCCTV.COM | 888-VITEK-70

SAGA “XL” Series 18 8. RECORD This button starts and stops the recording mode. 9. SLOW This button slows down the playback speed. Press this but

SAGA “XL” Series 1 PACKAGE CONTENTS Prior to installation of the SAGA series DVR, please verify that the packaging contains the following contents:

SAGA “XL” Series 19 19. ALARM RESET / LEFT DIRECTIONAL BUTTON a) Resets the alarm buzzer. b) Left pans in PTZ mode. c) Navigates left in the menu

SAGA “XL” Series 20 27. COPY / AUTOFOCUS a) Enters the copy menu screen. b) Switches the PTZ camera to auto focus mode in PTZ mode. 28. JOG SHUTT

SAGA “XL” Series 21 1. CAMERA INPUT BNC connectors for composite video signal input. 2. AUDIO INPUT RCA connectors for audio signal input. 3.

SAGA “XL” Series 22 16. VGA OUTPUT D-sub 15-pin connector for PC monitor out. 17. RS-232C Reserved. The RS-232C port can be used to connect a v

SAGA “XL” Series 23 2.3 IR REMOTE CONTROLLER 1. REMOTE CONTROLLER ID Select the remote controller ID. 2. IRIS C

SAGA “XL” Series 24 6. ALARM RESET / LEFT DIRECTIONAL BUTTON 7. MENU / UP DIRECTIONAL BUTTON 8. PIP / DOWN DIRECTIONAL BUTTON 9. DIGITAL ZOOM /

SAGA “XL” Series 25 2.4 MOUSE CONTROL 1. LEFT MOUSE BUTTON a) Double-click in the main window: status display. b) Double-click in the

SAGA “XL” Series 26 III. INSTALLATION AND CONNECTIONS 3.1 CONNECTIONS LAYOUT

SAGA “XL” Series 27 3.2 VT-XHD10U

SAGA “XL” Series 28 3.3 EXTERNAL TERMINAL CONNECTION 3.3.1 RS-422 / RS-485 3.3.2 TIME ADJUST DESCRIPTION No TERM OFF TERM ON

SAGA “XL” Series 2 RISK OF ELECTRICAL SHOCK WARNING TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOSE T

SAGA “XL” Series 29 3.3.3 RELAY OUTPUT 3.3.4 ALARM SENSOR INPUT NO DESCRIPTION NO DESCRIPTION 1 NO(Normal Open) 7 NO(Normal

SAGA “XL” Series 30 3.3.5 VGA PIN LAYOUT 3.3.6 RS-232C PIN LAYOUT No DESCRIPTION 1 RED(Red Video [75ohm, 0.7Vp-p] ) 2 GREEN(Green

SAGA “XL” Series 31 IV. BASIC OPERATION This section will cover basic features of the DVR, including its main screen and the explanation of some of t

SAGA “XL” Series 32 3. DATE AND TIME Current date and time is displayed when in live monitoring mode. Recorded date and time is displayed when in

SAGA “XL” Series 33 5. RECORD PROGRAM Displays current recording program. 6. RECORD TYPE Displays current event recording mode. 7. CELSIUS T

SAGA “XL” Series 34 20. USB STORAGE Displays the size of the external hard drive or USB Flash Memory. 21. USB CD / DVD Displays the status of

SAGA “XL” Series 35 4.3 LIVE VIEW The live view displays each channel at 30 frames per second, for the total of 240 frames per second for VT-XL840 an

SAGA “XL” Series 36 4.3.1.2 VT-XL840 4.3.2 FULL SCREEN DISPLAY Press the desired channel bu

SAGA “XL” Series 37 Press +10 button and then 2 button to display channel 12. 4.3.3 AUTOMATIC SEQUENCE Press the SEQ button to activate the

SAGA “XL” Series 38 4.4.1 SINGLE SCREEN VIEW MODE In single screen view mode, press the FREEZE button to freeze the live screen. As the scr

SAGA “XL” Series 3 DISCLAIMER While every effort has been made to ensure that the information contained in this guide is accurate and complete, no

SAGA “XL” Series 39 4.5 ZOOM During the live view mode or during the playback mode, it is possible to zoom into a section of the screen to get a digi

SAGA “XL” Series 40 Press the ESC button to exit out of the zoom mode. 4.6 PICTURE-IN-PICTURE Select the background channel by pressing th

SAGA “XL” Series 41 Press the ESC button to exit from the PIP mode. 4.7 SPOT MONITOR The spot monitor allows viewing of individual cameras

SAGA “XL” Series 42 Press the DISPLAY button to toggle between different view modes. As the 4A quad mode is shown in the main monitor, the sp

SAGA “XL” Series 43 The factory default record programs are as follows: RECORD PROGRAM 0 1 2 3 4 5 6 7 8 9 EVENT TYPE COMPLEX SINGLE SINGLE COMPLEX

SAGA “XL” Series 44 Press the DIRECTION button to change the playback direction. Press the PLAY / PAUSE button during the playback to pause t

SAGA “XL” Series 45 4.9.2.1 Shuttle Ring Turn the shuttle ring clockwise to fast forward to the desired location. Each increment on the shuttle ring

SAGA “XL” Series 46 4.9.3 PICTURE-BY-PICTURE Pause the playback by pressing the PLAY / PAUSE button. Turn the jog dial clockwise to review a

SAGA “XL” Series 47 4.9.5 LOOP PLAYBACK The playback can be marked in two different locations so that it can be looped repeatedly. During any play

SAGA “XL” Series 48 Press the CLEAR button to exit from the loop playback mode. 4.9.6 BOOKMARK The bookmark provides a quick and easy way t

SAGA “XL” Series 4 FCC NOTICE Saga Series Digital Video Recorders, VT-XL840, VT-XL1680 These devices comply with Part 15 of the FCC Rules. Operatio

SAGA “XL” Series 49 V. ADVANCED OPERATION This section will cover advanced features of the DVR such as backup (copy), pan tilt and zoom camera contro

SAGA “XL” Series 50 Select INTERNAL CD-RW/DVD by pressing the + or - buttons. Highlight MEDIA FORMAT, and then press the ENTER button to begi

SAGA “XL” Series 51 Select the location of the file to be backed up from. If the location is unknown, leave the HDD ID on NORMAL. Select the

SAGA “XL” Series 52 The backup progress is displayed on the right upper corner of the screen, and will disappear automatically when the backup process

SAGA “XL” Series 53 The beginning and the end of the available files are listed automatically as shown on the left. Select the beginning time

SAGA “XL” Series 54 Insert the CD into the CD-ROM or DVD-ROM of a computer, and the small player will load automatically showing all available data fo

SAGA “XL” Series 55 Select the location of the file to be backed up from. If the location is unknown, leave the HDD ID on NORMAL. Select the

SAGA “XL” Series 56 The backup progress is displayed on the right upper corner of the screen, and will disappear automatically when the backup process

SAGA “XL” Series 57 Displays the current copy status. 5.1.6 COPY STOP The backup process can be interrupted at any time during the process

SAGA “XL” Series 58 Highlight YES and then press the ENTER button to stop the backup process. 5.2 PAN / TILT / ZOOM CAMERA CONTROL The SAGA

SAGA “XL” Series 5 Read this First Test Sessions Before you try to record important subjects, we highly recommend that you make several test session

SAGA “XL” Series 59 5.2.2 CREATING AND MOVING TO PRESET POINTS During the PTZ control mode, press the PRESET button to activate the PTZ(PRESET)MOVE m

SAGA “XL” Series 60 notification e-mails if the e-mail addresses have been defined. Please see 6.4.8 RELAY OUTPUT under 6.4 EVENT SETUP section on pa

SAGA “XL” Series 61 5.3.3 MOTION RECORDING Motion recording is yet another effective form of event recording that is triggered when a channel detects

SAGA “XL” Series 62 The dates that contain recorded data will be displayed in green, whereas dates without data will be in white. Select the d

SAGA “XL” Series 63 5.4.2 SEARCH & COPY Search & copy allows a quick review of the recorded data and backup onto a medium, and thus minimizes

SAGA “XL” Series 64 If any of the channels need to be viewed in full screen mode, highlight CHANNEL and then press the + or – button to view a specifi

SAGA “XL” Series 65 When the password has been entered, “SAVE NEW COPY PASSWORD” will appear. The same message appears even if the ESC button has bee

SAGA “XL” Series 66 Select which hard disk drive to retrieve the data from. If unknown, leave the HDD ID on “NORMAL”. Select the year, month

SAGA “XL” Series 67 Press the SEARCH button to access the search screen. Highlight EVENT SEARCH and then press the ENTER button to access the

SAGA “XL” Series 68 Select the year, month, date, hour, minutes and seconds of the end of the data to retrieve. As the values change, the picture in

SAGA “XL” Series 6 SAFETY PRECAUTIONS Before using the Digital Video Recorder, please ensure that you read and understand the safety precautions de

SAGA “XL” Series 69 Highlight BLOCK SEARCH and then press the ENTER button to access the BLOCK SEARCH screen. Select the hard disk drive to re

SAGA “XL” Series 70 Maneuver through the playback as needed. Please see BASIC PLAYBACK on page 43. 5.4.6 FILE SEARCH File search is capable

SAGA “XL” Series 71 Press the ENTER button and the list of data will appear in chronological order, from the oldest to the most recent. Select

SAGA “XL” Series 72 Press the ENTER button to search for the list of bookmarks. Select the bookmark, and then press the ENTER button to start

SAGA “XL” Series 73 Highlight TEXT SEARCH and then press the ENTER button to access Text Search submenu. Select the hard disk drive to retri

SAGA “XL” Series 74 Enter the text to be searched. Leave black for a wild card (all item) search. Move the highlight to any location beside

SAGA “XL” Series 75 z Power on / off z Power loss / DVR restart z Changes in the menu z DVR initialization z HDD initialization z Network connec

SAGA “XL” Series 76 Press the ESC button and highlight SAVE LOG and then press the ENTER button to save the log file onto a USB flash memory. The USB

SAGA “XL” Series 77 VI. DVR MENU Press the MENU button to access the main menu of the DVR. The DVR menu consists of the following categories: Q

SAGA “XL” Series 78 6.1 QUICK SETUP Quick setup enables the user to quickly setup major recording settings of the DVR. All changes made in quick s

SAGA “XL” Series 7 Do not allow the equipment to come into contact with, or become immersed in, water or other liquids. Do not allow liquids to ent

SAGA “XL” Series 79 6.1.3 RECORD FRAME Record frame determines the overall recording speed of the DVR. The recording speed adjusts automatically acc

SAGA “XL” Series 80 6.1.6 POST-RECORD TIME Define the post-event recording time. Select from 0 to 60 seconds. The default is ten seconds.

SAGA “XL” Series 81 For more information regarding the REMOTE CONTROL ID, please see 6.5.6 REMOTE CONTROLLER ID under SYSTEM menu on page 112. The de

SAGA “XL” Series 82 6.2.2 AUTO SEQUENCE Highlight AUTO SEQUENCE and then press the ENTER button to access four pages of auto sequence submenu. Navig

SAGA “XL” Series 83 The fourth page lists the sequence display duration for channels 9 through 16 and the option to skip the channels with video loss.

SAGA “XL” Series 84 Select the display option for the recording status. The default is on. Select the display option for the date and the ti

SAGA “XL” Series 85 Select the border color that divides the channels. The default is white. Select the display option for the remote contro

SAGA “XL” Series 86 Navigate through the characters by using the directional buttons, and advance through the characters using the + or – buttons. Pr

SAGA “XL” Series 87 Highlight the channel to customize, and then press the + or – button to select the desired channel. 6.2.6 COVERT Highli

SAGA “XL” Series 88 Select the covert mode application. By default, the live view, playback and network are affected by the covert mode. Available o

SAGA “XL” Series 8 PREVENTING MALFUNCTION Avoid Strong Magnetic Fields. Never place the Digital Video Recorder in close proximity to electric mot

SAGA “XL” Series 89 Define the spot monitor sequence mode time from 1 to 60 seconds. The default is 3 seconds. Enable or disable the multi c

SAGA “XL” Series 90 Adjust the brightness. The default is 50%. Adjust the contrast. The default is 50%. Adjust the hue. The def

SAGA “XL” Series 91 6.3 RECORD Record setup defines various recording options such as record schedule, record programs, recording time estimate, au

SAGA “XL” Series 92 1. All Select the program for the whole day by changing the value in this section. 2. Current hour block Highlights the

SAGA “XL” Series 93 Any of the record settings can be customized once in the record program mode. Any changes made will be effective only to the hour

SAGA “XL” Series 94 1. RECORD PROGRAM There are 10 available record programs, from program 0 through program 9, where program 0 reflects the QUICK SET

SAGA “XL” Series 95 A. Single Mode Single Mode event recording allows recording a specific channel at up to 30 pictures per second regardless of the

SAGA “XL” Series 96 Please note that the total of the Single Mode event recording rate of 432 PPS exceeds the maximum D1 resolution record rate of 120

SAGA “XL” Series 97 The illustration shows that at any given time, a channel would record at 27 PPS when an alarm circuit is triggered, whereas the re

SAGA “XL” Series 98 9. CHANNELS The channels can be swapped so that any combination of channels can be selected to be recorded within a group. The f