Vitek VT-PTZ36 Instrukcja Obsługi

BBLLAACCKKYYEELLLLOOWWMMAAGGEENNTTAACCYYAANNVITEKVT-PTZ Series Xpress Dome with 18x, 26xor 36x Optical Zoom • True Night Shot (D/N) Function with Auto

VT-PTZ Series 9 TABLE OF CONTENTS CONTENT VERIFICATION...

VT-PTZ Series 10 3.1.3.3 Deleting a programmed pattern. ... 35 3.1.3.4 Save and Exit ...

VT-PTZ Series 11 3.4.1.1 Mode... 63 3.4.1.2 AF

VT-PTZ Series 12 3.5.9 SYSTEM INFORMATION... 81 3.5.10 EXIT ...

VT-PTZ Series 13 I. INTRODUCTION 1.1 FEATURES The Xpress Dome features a high resolution Exview HAD** CCD imager for enhanced lowlight sensitivity

VT-PTZ Series 14 Movement 64 steps of variable speed from 0.1°/sec to 90°/sec. Max manual speed 360°/sec with Turbo key pressed, Preset speed is 3

VT-PTZ Series 15 1.2 SYSTEM CONFIGURATION AND CONNECTION Additional joystick keyboard controllers such as the Xpress Keyboard (VT-KBD1) and a variety

VT-PTZ Series 16 II. INSTALLATION 2.1 Connection Diagram The base of the Xpress Dome 2.2 Termination Any device that is at th

VT-PTZ Series 17 The following diagram displays the dip switch settings for termination. The following diagrams are some sample examples o

VT-PTZ Series 18 2.3 DOME CAMERA ADDRESS (ID) All devices connected in the chain must possess a unique address. If any of the devices possess the sa

VT-PTZ Series 1 CONTENTS VERIFICATION Prior to installation of the Xpress Series Dome camera, please verify that the packaging contains the followin

VT-PTZ Series 19 Dip Switches (S5) Protocol 1 2 3 4 Automatic Protocol Detection Off Off Off Off EZ, S2/E, PL, ER, PH (Even Parity) On Off Off

VT-PTZ Series 20 RS-485 ① Connect the wires to the TX+/TX- ports on the control device. ② Connect to the RX+/RX- ports on the Speed Dome. RS-422 ① S

VT-PTZ Series 21 1. COM A / COM B Connect the wire for the alarm output with either COM A or COM B, whether NC or NO circuits are used.

VT-PTZ Series 22 5. Alarm 1 ~ 8 Connect the wire to the appropriate alarm input. Up to eight alarm wires can be connected. 2.7 MOUNTING THE SPEED

VT-PTZ Series 23 2.8 POWER ON AND BOOT UP SEQUENCE When the Speed Dome is twisted in and locked onto the base module, it will be powered on and will

VT-PTZ Series 24 If any of the diagnostic sequence is disturbed or is malfunctioning, then an error message will appear to the specific function.

VT-PTZ Series 25 III. PROGRAMMING AND OPERATION Provided that all connections are properly made, the Speed Dome which needs to be programmed must

VT-PTZ Series 26 Button or Joystick movement in Menu Function 1. Go into submenus 2. Execute a command 3. Change Values LEFT OR RIGHT 4. Navigat

VT-PTZ Series 27 3.1 FUNCTION FUNCTION menu consists of the main key functions of the Xpress Dome, where the HOME FUNCTION, PRESET, PATTER, SCAN a

VT-PTZ Series 28 3.1.1.2 Number Select the number of the programmed function to be run. 3.1.1.3 Time Select from 10 seconds to 240 seconds

VT-PTZ Series 2 RISK OF ELECTRICK SHOCK WARNING TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOSE THIS

VT-PTZ Series 29 3.1.2 PRESET PRESET supports up to 248 PAN, TILT, ZOOM, FOCUS and IRIS positions and settings. Once programmed, the p

VT-PTZ Series 30 3) Move the joystick around to select the desired pan, tilt and zoom position. 4) Press the FOCUS button to program the sel

VT-PTZ Series 31 2) Press and hold down the SHIFT button and the “Select Position” will start flashing. 3) Do not let go of the SHIFT butto

VT-PTZ Series 32 3.1.2.5 Previous / Next Page Highlight and move the joystick left or right to switch between the 31 pages of preset pages. There ar

VT-PTZ Series 33 3.1.3.1 Programming a pattern. 1) Select an empty pattern number. 2) Twist the joystick to activate the programming wind

VT-PTZ Series 34 3.1.3.2 Alternate method of programming a pattern. 1) Select an empty pattern number. 2) Press and hold down the SHIFT

VT-PTZ Series 35 3.1.3.3 Deleting a programmed pattern. 1) Move the joystick to highlight the desired pattern number. 2) Press the OFF butt

VT-PTZ Series 36 3.1.4 SCAN (VECTOR SCAN). SCAN supports up to 16 programmed sections of angles at eight programmable speeds, also known

VT-PTZ Series 37 3) Select the speed of the scan. Available speeds are: 1 through 8 (8 being the fastest), Slow and Medium. The Default speed is

VT-PTZ Series 38 3.1.4.2 Alternate method of programming a scan. 1) Highlight START, and then press and hold the SHIFT button. 2) Do not

VT-PTZ Series 3 DISCLAIMER • While every effort has been made to ensure that the information contained in this guide is accurate and complete, no l

VT-PTZ Series 39 6) When the desired location is selected, let go of the SHIFT button to finish programming the end point. 3.1.4.3 Direction.

VT-PTZ Series 40 3.1.5 TOUR There are eight programmable Tours. Each tour consists of up to eight preset positions, patterns, scans or

VT-PTZ Series 41 3.1.5.1 Programming a Tour with Preset Programs. 1) Select the Tour by moving the joystick left or right. 2) Twist the joy

VT-PTZ Series 42 6) Select from the three available speeds, F (Fast), M (Medium) and S (Slow) for the camera movement. The default is F. 7)

VT-PTZ Series 43 3) Move the joystick to the right and twist the joystick to select the pattern program. 4) Select from the three available

VT-PTZ Series 44 2) Press the SCAN button. When the SCAN button is pressed, the first program is entered automatically. 3) Move the joystick t

VT-PTZ Series 45 3.1.5.4 Combining PRESET, PATTERN, SCAN and TOUR. 1) Using the process to enter the preset, patter and scan, any of the functions

VT-PTZ Series 46 3.1.5.6 Previous / Next Page. Highlight and move the joystick left or right to switch between the eight available pages per tour, fo

VT-PTZ Series 47 3.2 ALARM ALARM menu configures the eight alarm inputs and two alarm outputs. The alarm inputs can be programmed to work in con

VT-PTZ Series 48 3) Select the priority of the function. There are nine levels of priority. There is only one level 0 which overrides any other leve

VT-PTZ Series 4 FCC NOTICE Xpress Domes, VT-PTZ18, VT-PTZ26 These devices comply with Part 15 of the FCC Rules. Operation is subject to the followi

VT-PTZ Series 49 3.2.2 SAVE AND EXIT Save the changes and exits to the main FUNCTION menu. 3.2.3 DELETING AN ALARM 1) Move the joystick to h

VT-PTZ Series 50 3.2.4 SAMPLE SCENARIO As the priority and the functions settings may be confusing, please refer to the following sample scenario for

VT-PTZ Series 51 3.3 SCREEN SCREEN menu consists of the screen related features, where the LANGUAGE, PRIVACY ZONE, NORTH DIRECTION, ZONE TITLE,

VT-PTZ Series 52 Privacy zones offers up to eight independent areas that can be either masked off or have the camera’s view off to prevent viewing of

VT-PTZ Series 53 5) Twist the joystick to enter up to 16 alphanumeric characters. 6) Select the privacy zone to be ON or OFF. 7) S

VT-PTZ Series 54 3) Let go of the SHIFT button to finish programming the preset position. 3.3.2.3 Privacy zones displayed on screen per type.

VT-PTZ Series 55 2) Press the OFF button to delete the selected privacy zone. 3.3.2.5 Save and Exit. Save the changes and exits to the main

VT-PTZ Series 56 3.3.3.1 Display On / Off Select the North Direction display On or Off. 3.3.3.2 Position 1) Twist the joystick to enter the

VT-PTZ Series 57 3.3.3.3 Save and Exit Save the changes and exits to the main SCREEN menu. 3.3.4 ZONE TITLE There are a total

VT-PTZ Series 58 2) Twist the joystick and “Select Position” will start flashing. Move the joystick around to select the desired pan, tilt and zoom

VT-PTZ Series 5 READ THIS FIRST Test Sessions Before you try to record important subjects, we highly recommend that you make several test sessions

VT-PTZ Series 59 7) Move the joystick to TITLE column of the same zone number. 8) Twist the joystick to enter up to 16 alphanumeric characte

VT-PTZ Series 60 3) Let go of the SHIFT button to finish programming the START location of the zone title. 4) Move the joystick to the END c

VT-PTZ Series 61 3.3.4.4 Previous / Next Page Highlight and move the joystick left or right to switch between the four pages of zone title pages. T

VT-PTZ Series 62 3.3.4.2 Display Select the display mode of the camera title, ON or OFF. 3.3.4.3 Position Select the display mode of the X

VT-PTZ Series 63 3.4 CAMERA CAMERA menu allows customization of the camera module installed in the Xpress Dome. The options consist of FOCUS CON

VT-PTZ Series 64 3.4.1.2 AF Sensitivity (Automatic Focus Sensitivity) Available Automatic Focus Sensitivity modes are LOW and HIGH. Automatic Focus

VT-PTZ Series 65 3.4.2.2 R Gain (Red Gain) Adjust the Red Gain in MANUAL mode. 3.4.2.3 B Gain (Blue Gain) Adjust the Blue Gain in MANUAL

VT-PTZ Series 66 AE CONTROL adjusts the exposure of the lens. As different brightnesses affect the picture differently, it enables the lens to automa

VT-PTZ Series 67 3.4.3.5 Brightness Adjust the brightness of the picture. Available options are 0 through 31. 3.4.3.6 Shutter Adjust the

VT-PTZ Series 68 Line Lock allows adjusting the picture’s phase rate with other monitors, switchers, and cameras. 3.4.4.1 Mode Select the mode for

VT-PTZ Series 6 SAFETY PRECAUTIONS z Before using the Xpress Dome, please ensure that you read and understand the safety precautions described below

VT-PTZ Series 69 3.4.6 SHARPNESS CONTROL Control the sharpness of the picture digitally. Available options are 0 through 63. The default value is

VT-PTZ Series 70 3.4.8.1 Mode Select between Auto and Manual mode. The camera will switch automatically between the day and night modes based on the

VT-PTZ Series 71 3.5 SETUP Setup allows customization of the mechanics of the Xpress Dome. The options consist of FLIP, SPEED, PANNING RANGE, TIL

VT-PTZ Series 72 3.5.3 SPEED Select the default speed of the camera movement when the camera is controlled manually. Select from Fast, Medium and Sl

VT-PTZ Series 73 2) Twist the joystick to activate the programming window. “Select Position” will start flashing. Move the joystick around to sele

VT-PTZ Series 74 7) Switch Enable to “ON” to activate the Pan Range Limit. 8) Sometimes, the Pan Range Limit may be the opposite of the int

VT-PTZ Series 75 3) Do not let go of the SHIFT button, and move the joystick around to select the desired pan position. 4) Let go of the SH

VT-PTZ Series 76 8) Let go of the SHIFT button to finish programming the pan position. 3.5.4.3 Save and Exit Save the changes and exit to t

VT-PTZ Series 77 3.5.5.2 On The tilt range of the Xpress Dome is limited to -5 degrees and 185 degrees. In other words, the tilt range is above the

VT-PTZ Series 78 3.5.6.1 Origin Reset Origin Reset reverts the point of origin, or the point of reference back to when the Xpress Dome was first powe

VT-PTZ Series 7 z Do not use substances containing alcohol, benzene, thinners or other flammable substances to clean or maintain the equipment. The

VT-PTZ Series 79 2) Move the joystick around to select the desired point of origin. 3) Press the FOCUS button to program the new point of

VT-PTZ Series 80 3.5.6.5 Save and Exit Save the settings and exit to the Setup menu. 3.5.7 FACTORY DEFAULT Revert all settin

VT-PTZ Series 81 3.5.9 SYSTEM INFORMATION Displays basic information about the Xpress Dome, including the module type, hardware revisio

VT-PTZ Series 82 IV. SPECIFICATIONS VT-PTZ18 VT-PTZ26 VT-PTZ36 Image Sensor 1/4" Interline Transfer CCD Effective Pixels 768(H) X 494(V) Horiz

VT-PTZ Series 83 V. GLOSSARY ALARM ACTIONS The assigned responses of the dome camera when there is input status change. The dome may call Presets fo

VT-PTZ Series 84 INPUT DEVICES External devices that provide information about the condition of system components that connect to the inputs on the do

VT-PTZ Series 85 values for the setting range from 1/2 to 1/60. The default setting is 1/4. WHITE BALANCE Adjustments in the color hue (red and blue)

VT-PTZ Series 86 VI. FUNCTION SHORTCUTS Short Cut Key Function PRST Pop up preset setup menu. TOUR Pop up guard Tour setup menu. PTRN Pop up Pa

28492 CONSTELLATION ROAD VALENCIA, CA 91355WWW.VITEKCCTV.COM | 888-VITEK-70

VT-PTZ Series 8 CAUTION z Avoid using, placing or storing the equipment in places subject to strong sunlight or high temperatures, such as the green